PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538915.1_FGP015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23448.9 Da    PI: 10.1197
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538915.1_FGP015genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.52.1e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krienk+ rqvtf+kRrng+lKKA+EL +LCdae+a+i+fss+g+lye+s+
  KN538915.1_FGP015  9 KRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIVFSSRGRLYEFSN 59
                       79***********************************************95 PP

2K-box104.81.1e-3484173998
              K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                         + + +++ qqe+ak++ +i++Lq+ +Rhl+Ge++++ + keL++Le++Lek++++iRskK+ell+++ie++qk+e +lq+en  Lr+k+
  KN538915.1_FGP015  84 IDVNSHQYFQQEAAKMRHQIQTLQNANRHLIGESIGNVTAKELKSLENRLEKGISRIRSKKHELLFSEIEYMQKREADLQNENIFLRAKV 173
                        566889*********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.305161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-31275IPR002100Transcription factor, MADS-box
CDDcd002651.20E-41276No hitNo description
PRINTSPR004046.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-2886173IPR002487Transcription factor, K-box
PROSITE profilePS5129713.37289184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRGKIEIKR IENKTSRQVT FCKRRNGLLK KAYELAILCD AEIALIVFSS RGRLYEFSNV  60
NSTRSTIERY KKASASTSGS APVIDVNSHQ YFQQEAAKMR HQIQTLQNAN RHLIGESIGN  120
VTAKELKSLE NRLEKGISRI RSKKHELLFS EIEYMQKREA DLQNENIFLR AKVYTDKFKG  180
SCDLLYLQIF HDFSKGLEEI KEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19164164Myocyte-specific enhancer factor 2B
1tqe_Q3e-19164164Myocyte-specific enhancer factor 2B
1tqe_R3e-19164164Myocyte-specific enhancer factor 2B
1tqe_S3e-19164164Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0709580.0AK070958.1 Oryza sativa Japonica Group cDNA clone:J023065L09, full insert sequence.
GenBankAY5519130.0AY551913.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS207 mRNA, complete cds.
GenBankFJ7509440.0FJ750944.1 Oryza sativa clone KCS020C02 MADS-box transcription factor 21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621182.11e-122PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-124MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A0D9YIC91e-122A0A0D9YIC9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004940-PA1e-121(Oryza sativa Indica Group)
STRINGLOC_Os01g66290.11e-121(Oryza sativa Japonica Group)
STRINGORGLA01G0336500.11e-122(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.12e-85MIKC_MADS family protein